About Burntout
Joined May 2010
Hi. My name is Art. I have been living in the brick and mortar world for 57 years and have just begun exploring this between world called cyberspace. I am excited to explore the possibilities that are out here and pleased to read the term "hard work" as that is one of the few aspects of internet business that makes much sense to me. I am looking forward to learning what I can. I know that this will take lots of work before I can begin to understand all that is here. Whether I succeed of fail I would like to make note that this program is the only program I have seen that has the good sense to not promise a fortune. In the work a day world where I come from there is no easy money. I suspect it is the same here. I am grateful for the chance to explore. I wish all of you success and wellness of being.
Burntout's Accomplishments

Leave burntout a Message
Write something…
Recent messages
HotBizMan Premium
Here is a program I hope you will take a look at. And a question for you. Why are people so afraid today to take a very small risk (heck no risk right now) in a prelaunch program that can really help them to grow their business by leaps and bounds? Go here now and just take a look around. Just copy and paste the link. Seems like WA won't let it become a clickable link. http://www.zingbizpro.com/?ZBP?=hotbizman
burntout Premium
Pretty vague. MLM? Paid social networking for business's? I'm pretty busy just chasing my tail. How can I manage more time to scratch for fleas? I think for now I'll just stick to the basics. Best of luck to you!
sakura012 Premium
Thanks for your very inspiring comment! It has given me the boost that I needed. :)
burntout Premium
Randy, just get the free traffic travis which is a pretty good tool and they'll keep you linked up to some great freebies. Yeah I am cheap...glad to hear your getting a little action. Moving concrete block must be a strong motivater! take care, Art
Randy Ledbetter Premium
Hey Art! Thanks so much for the SEO tip! I watched the video late lastnight. that guy really knew what he was talking about. I'm actually considering subscribing to their network. It makes sense. I must admit that about half way through the video, I was feeling pretty much out of my league. Intimidated about it all and wondering if I even have what it takes to accomplish such a deep SEO routine. Hey! I got my first subscriber to the MAD Marketing Method Internet Course. I'm so stoked! No income, but it feels good anyway! I just wanted to say thank you, Art. I hope you are doing well, and I really look forward to hearing from you again. Take it easy!
Randy Ledbetter Premium
Hey, Art! Sorry for being silent for so long. I got a visit from my cousin, Melissa. She was pretty demanding with my time. This is the first time since Saturday that I've been working toward IM. I was happy to see your message. Things are going well. I'm enrolled in the Article Marketing Club and spent four hours tonight doing keyword research. Here's some of the better ones, enjoy! internet video marketing,what is internet marketing,online advertising marketing,internet marketing optimization,online marketing software,online marketing jobs,make money online fast,affiliate pay per click,profitable article marketing. I have about eight other general categories to go, but I need to take a break! Gotta lug concrete blocks around tomorrow! Have a wonderful night, Art! Hope to hear from you soon. Randy
burntout Premium
Randy, sent you a PM.
Randy Ledbetter Premium
Hey Art! This is Randy! Sorry for not checking in sooner! I hope you had a wonderful holiday season! I did. I was able to speak with my family in Oklahoma on the phone. I've been ultra-busy on my site, and I've finally finished it. It took me about a month and 250 hours, but I did it. I hope that if you have time you will give it a quick look over and let me know if I can improve it. This is not a ploy to get your business, bro! In fact, I will refuse to ever sell you anything! You're just one of my best WA buddies and I would really appreciate some constructive feedback. If you do not have time, I totally understand! Anyway, I hope you'll drop me a line or two and let me know what's up with you of late. Take care and have a wonderful day! Oh!! Duh! I forgot to give you the URL! Idiot!:) http:/www.onlinemarketingtipsandreviews.com/ you have to search for it using Google as it is not visible under Yahoo yet. Anyway, take care and have a good one!
Randy Ledbetter Premium
Hey Art! Thank you very much for the exremely helpful advice. I did not know these things. I remember reading that I should take advantage of the site's help feature and the forum, but for some reason I found myself using the search box which produced lists of semi-related tutorials that often didn't work for me for some reason or the other. I am very appreciative of your guidance in this area and the assurance that I don't have to feel ashamed to ask basic questions on the forum. It means alot to me that you took time to look out for me in that regard! Thank you. I only have three pieces of gold, but I'm giving you one of them! I made good progress today on my site and found a large selection of e-book/video affiliate marketing products that I can buy for dirt cheap and give away as free bonuses on my site. You probably know all about it, but I was impressed by the content I found there. www.master-resale-rights.com. Anyway, take care Art and I hope to hear from you soon. Randy
burntout Premium
Randy, I am pleased to share anything I have learned. Be free to ask anything. If I can offer some insight that saves you some grief or speeds you along let me know. Sounds like your getting a pretty good jump on things anyway. Keep me posted, Art
Randy Ledbetter Premium
Hey, Art! Thanks for the message! Yeah, I've been working full time at my day job and working about 50 hours a week on this internet marketing. I really must admit that the website development is a big task. I don't see myself getting it ready enough to actually tie articles to it for another two weeks. It took me 36 hours just to figure out how to change the size of the font in my header! I feel like such an idiot. I was making the changes in the HTML coding, and not seeing the change take place visually, so I'd immediately change the code back to what it was before so I wouldn't screw up my site too badly. I finally stumbled across an article in a WordPress forum that suggested refreshing the webpage. Duh! We live and we learn, no? Don't you dare let that website rot! I won't have it! Come on! Let's make this happen! You have a wonderful day, Art. Randy
burntout Premium
Randy, I admire your tenacity, solving the riddles associated with website building are real fatiquing. I am sure you are aware of these things but I will offer them in good faith, maybe it will save you some headaches. Help on the right most tab of the WA home page has a site map on it that makes finding lots of information simple. The search forum will return good results if you type in word press. On your word press dash board click on the help tab, click on documentation and there are answers to virtually every aspect of your web site development, I think it is downloadable. Type "word press you tube" into your browser and you will find start to finish video on building wordpress sites. Lastly post questions in the forum it will surprise you who surfaces and answers your questions. My guess is you probably already know about these things but I hashed around a long time before I figured these things out. Don't ever feel stupid about this stuff. Your learning website design, business, writing skills, seo, and a bunch of other things that make my head hurt. Every one in this program respects that each of us has different learning needs. There just are not any stupid questions. I wish I had half your drive maybe I would have that website of mine producing. Call me Slo! Take care and I wish you success in all things. Art
Randy Ledbetter Premium
Hi Art! This is Randy. Just checking in to say hello. I hope things are going well for you. I'm busy working on my WordPress site, onlinemarketingtipsandreviews.com. I have a long way to go, but I know if I keep chipping away at the tasks, it will happen! I wish you great success!
burntout Premium
Hey Randy, that a pretty big bite all at once! I have a wordpress sitting out there in cyberspace rotting. :) I can't quite decide what to do with it. I'm glad to hear your making good progress. Keep after it and let me know when you have some tips on your blog so I can go figure this stuff out too... best luck.
burntout Premium
Hey Randy, that a pretty big bite all at once! I have a wordpress sitting out there in cyberspace rotting. :) I can't quite decide what to do with it. I'm glad to hear your making good progress. Keep after it and let me know when you have some tips on your blog so I can go figure this stuff out too... best luck.
burntout Premium
Thats one tall, leggy girl. Get her there. She looks good enough to pay your way if you do. :)
Randy Ledbetter Premium
Hi Art! Thanks for the message! I'm glad I'm not the only one who has felt overwhelmed! I like the fact that you have hung in there no matter what. That's the approach I am committed to taking. Right now, I work eight hours a day, and I can't sit down to do this until about 7 at night. Consequently, I'm not going to be getting much sleep! But that's okay because I want more for my life than what I currently have. I'm doing the WA Super Affiliate Getting Started tutorial. Ultimately, I'd like to set up a site that is just a huge collection of blogs reviewing affiliate marketing products. I need to buy a domain that people can connect to after reading my future articles but I am uncertain what function that site should perform. I'd like to figure that out because it makes a difference on what domain name I choose. Arrgghh! Anyway, you have a wonderful night and I wish you many sales! Randy
Randy Ledbetter Premium
Hey Art! Thanks for the greeting and the words of encouragement. I too am currently slaving away at a very dirty and physically taxing day job. I really hope my efforts here pay off. I believe in hard work, and I am excited about the prospect of building a future for myself and breaking free from the need to make a living with back-breaking work. I must admit that the wealth of information here is somewhat overwhelming. I hope we both succeed, Art. Feel free to contact me any time. Randy
burntout Premium
Hi Randy. The information is overwhelming. Five months into this, its still overwhelming... but I keep clawing away at it. One of the things that makes it easy is after you realize the potential for success you get pretty hooked on it. This stuff all does make sense but it will probably give you head ache or two before does. Let me know how it goes.
PMV Premium
I just LOVE that monkey :)
burntout Premium
He does have a certain charm alright. Can you believe he was an unwanted toy and was faceing certain demise in a landfill? I could not bear the thought and paid the eight nine cents to save his life. He has since lit the way on numerous dark journeys! :)
bkb2012 Premium
Hey there burntout --- just wanted to check in and find out how it's going? Feel free to ask for help and we'll get you going further. Barbara...bkb2012.
burntout Premium
Hi Barbara. I appreciate your interest in my progress. I am struggling with how to approach this process with enough impact to actually make any money. Squidoo and ezine seem to take my articles and I purchased a dreadful domain name that I used on an W.A. blog site. I have an aweber account set up on the remote chance someone stumbles onto it. I see the potential for sucess in online marketing but I am a somewhat crushed by the "competition". Anyway I have let things rest the last little while to let my head clear and try to think of an approach to this that is not so amateurish. I read my own stuff and wonder what I was thinking... One thing is sure my presence through absence online is not likely to be noticed. My thinking now is a focused domain name that encompases the niche name, an absolutely awsome website that rivals Bill Gates, fresh, qaulity content that absolutely enthralls and leaves people desparate to buy whatever it is I'm selling! :) Work on back links and sift through the most sought after products on the internet and choosing the one that every one wants but doesn't have that is not being sold by anyone but me. Simple as that. O.K. so any ideas you have would be greatly appreciated as, to coin a term I see to much of here, "I'm overwhelmed!" Honestly, any advice you can give is an appreciated gift. Thank you.
Kewl Web Premium
Hi Art. I think you sent some gold my way. Thank-you very much! I have added you to my buddy list. All The Best! Devan
burntout Premium
Hi Deven. The post on mx settings and handling the mail settings in plesk was a real help. Thanks
andys43us Premium
Hey Welcome. Your profile pic gave me a good laugh. All The Best!!!
burntout Premium
He has been a good companian and has lit the way through many, dark, unpredictable internet journeys. My worthy guide has agreed to show me the way to untold wealth in my quest at WA. If I can help you in any way please feel free to ask.
IggyK Premium
Nice to meet you Art
mag375 Premium
Hi Art. It's great having you aboard. I'm a newbie with WA and am excited working this system. There is a wealth of information and it is hard work and if you stick with it, I'm sure you will profit from it. I am not a stranger with affiliate marketing and if I can be of any help, please do not hesitate to contact me.
webkab Premium
You've come to the right place at the right time. There's lots if info here at WA. Follow the training material and go to blogs like at potpiegirls. There you will find some easy instructions. Best of luck to you.
burntout Premium
Bill, thank you for the direction. I am so new to all of this that assimilating enough info to make the right decisions in what I produce has kept me out of the water. Hope to begin implementing some of the great resources here soon.
Sherion Premium
Hi Art and Welcome to WA. You joined just a couple of days before I did. I am a newbie too. Let me know if I can be of any help. I am in lesson 3 now, at the end of it, and I have learned so much. Also, I put some resources on my blog for us newbies who may not know all the terms. Best Wishes to you. You can do this.
PMV Premium
Hey Art, Sounds like you've got a great and realistic approach :) Enjoy and keep us up to date!
jatdebeaune Premium
Hey Art, Glad to be buddies. Thanks for the add.
FatWallet Premium
Hi Art, Welcome to WA!
FatWallet Premium
You will have seen FatWalet... once you go thru WA Action Plan and start taking action... good luck to you!
burntout Premium
Fat wallet? Have'nt seen one in years.... thank you!
Louise M. Premium
Hi and WELCOME! Glad to have you here!
Feel free to contact me if you need help. Good luck! :)
burntout Premium
Thank you very much. The offer for help does not go unnoticed. I am a stranger in a strange land.
burntout Premium
Hello all. My name is Art. I am absolutely without a clue as to what I am doing. Through the years, like every one I suppose, I have looked at internet business, done some research on them and gone running for cover. This is first time I have paid for a program. I made myself a bet I was throwing the money away! I am pleased to say that I am wrong. If all I do here is explore it will more than justify the investment as it will once and for all satisfy my curiosity about the viability of earning money on the internet. I am excited to learn and apply what I learn to a profitable enterprise, if it seems some thing that I can do. I have started the twelve week course and appreciate any one willing to buddy with me. If any one wants to tell me that a complete bone head can find some level of success out here, I would be grateful, as that seems to be the skill level I am starting from. I wish all of you luck in your endeavers and thank you for reading.
Jamie Smith Premium
Welcome to the WA family
burntout Premium
Bassman, thanks for the welcome. This looks to be an an interesting journey...
burntout Premium
Bassman, thanks for the welcome. This looks to be an an interesting journey...